Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,789
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 12,695
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 12,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 12,556
  5. Avatar for Go Science 5. Go Science 29 pts. 12,460
  6. Avatar for Contenders 6. Contenders 20 pts. 12,414
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,381
  8. Avatar for Russian team 8. Russian team 9 pts. 12,197
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 12,051
  10. Avatar for Hold My Beer 10. Hold My Beer 4 pts. 11,905
  1. Avatar for phi16 11. phi16 Lv 1 68 pts. 12,401
  2. Avatar for johnmitch 12. johnmitch Lv 1 65 pts. 12,392
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 63 pts. 12,375
  4. Avatar for grogar7 14. grogar7 Lv 1 60 pts. 12,362
  5. Avatar for anthion 15. anthion Lv 1 58 pts. 12,332
  6. Avatar for georg137 16. georg137 Lv 1 55 pts. 12,328
  7. Avatar for cbwest 17. cbwest Lv 1 53 pts. 12,298
  8. Avatar for fiendish_ghoul 18. fiendish_ghoul Lv 1 51 pts. 12,285
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 49 pts. 12,277
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 47 pts. 12,252

Comments