Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,729
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,661
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 11,424
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 11,251
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 11,218
  6. Avatar for GUGITBIOTECH 16. GUGITBIOTECH 1 pt. 10,973
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 10,176
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 10,009
  9. Avatar for Deleted group 19. Deleted group pts. 4,514
  1. Avatar for Idiotboy 21. Idiotboy Lv 1 45 pts. 12,225
  2. Avatar for NinjaGreg 22. NinjaGreg Lv 1 43 pts. 12,220
  3. Avatar for Phyx 23. Phyx Lv 1 41 pts. 12,220
  4. Avatar for vakobo 24. vakobo Lv 1 39 pts. 12,197
  5. Avatar for TastyMunchies 25. TastyMunchies Lv 1 37 pts. 12,156
  6. Avatar for Merf 26. Merf Lv 1 36 pts. 12,130
  7. Avatar for diamonddays 27. diamonddays Lv 1 34 pts. 12,094
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 33 pts. 12,087
  9. Avatar for Deleted player 29. Deleted player pts. 12,081
  10. Avatar for silent gene 30. silent gene Lv 1 30 pts. 12,052

Comments