Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,789
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 12,695
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 12,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 12,556
  5. Avatar for Go Science 5. Go Science 29 pts. 12,460
  6. Avatar for Contenders 6. Contenders 20 pts. 12,414
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,381
  8. Avatar for Russian team 8. Russian team 9 pts. 12,197
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 12,051
  10. Avatar for Hold My Beer 10. Hold My Beer 4 pts. 11,905

  1. Avatar for Idiotboy 21. Idiotboy Lv 1 45 pts. 12,225
  2. Avatar for NinjaGreg 22. NinjaGreg Lv 1 43 pts. 12,220
  3. Avatar for Phyx 23. Phyx Lv 1 41 pts. 12,220
  4. Avatar for vakobo 24. vakobo Lv 1 39 pts. 12,197
  5. Avatar for TastyMunchies 25. TastyMunchies Lv 1 37 pts. 12,156
  6. Avatar for Merf 26. Merf Lv 1 36 pts. 12,130
  7. Avatar for diamonddays 27. diamonddays Lv 1 34 pts. 12,094
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 33 pts. 12,087
  9. Avatar for Deleted player 29. Deleted player pts. 12,081
  10. Avatar for silent gene 30. silent gene Lv 1 30 pts. 12,052

Comments