Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470

  1. Avatar for Albatross795 111. Albatross795 Lv 1 1 pt. 9,301
  2. Avatar for spk23 112. spk23 Lv 1 1 pt. 9,032
  3. Avatar for kangchingfan 113. kangchingfan Lv 1 1 pt. 8,747
  4. Avatar for mmbhatti 114. mmbhatti Lv 1 1 pt. 8,063
  5. Avatar for drumpeter18yrs9yrs 115. drumpeter18yrs9yrs Lv 1 1 pt. 7,282
  6. Avatar for 01010011111 116. 01010011111 Lv 1 1 pt. 6,927
  7. Avatar for mrwillbarnz 117. mrwillbarnz Lv 1 1 pt. 5,725
  8. Avatar for gdnskye 118. gdnskye Lv 1 1 pt. 5,352
  9. Avatar for LanceKnight 119. LanceKnight Lv 1 1 pt. 5,352

Comments