Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 11,749
  2. Avatar for Go Science 2. Go Science 70 pts. 11,732
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 11,729
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,685
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 11,670
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 11,572
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 11,489
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 11,472
  9. Avatar for Russian team 9. Russian team 2 pts. 11,441
  10. Avatar for Contenders 10. Contenders 1 pt. 11,417
  1. Avatar for Albatross795 111. Albatross795 Lv 1 1 pt. 9,301
  2. Avatar for spk23 112. spk23 Lv 1 1 pt. 9,032
  3. Avatar for kangchingfan 113. kangchingfan Lv 1 1 pt. 8,747
  4. Avatar for mmbhatti 114. mmbhatti Lv 1 1 pt. 8,063
  5. Avatar for drumpeter18yrs9yrs 115. drumpeter18yrs9yrs Lv 1 1 pt. 7,282
  6. Avatar for 01010011111 116. 01010011111 Lv 1 1 pt. 6,927
  7. Avatar for mrwillbarnz 117. mrwillbarnz Lv 1 1 pt. 5,725
  8. Avatar for gdnskye 118. gdnskye Lv 1 1 pt. 5,352
  9. Avatar for LanceKnight 119. LanceKnight Lv 1 1 pt. 5,352

Comments