Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 65 pts. 11,580
  2. Avatar for nicobul 12. nicobul Lv 1 62 pts. 11,572
  3. Avatar for jobo0502 13. jobo0502 Lv 1 59 pts. 11,557
  4. Avatar for frood66 14. frood66 Lv 1 56 pts. 11,553
  5. Avatar for smilingone 15. smilingone Lv 1 54 pts. 11,493
  6. Avatar for O Seki To 16. O Seki To Lv 1 51 pts. 11,489
  7. Avatar for pvc78 17. pvc78 Lv 1 49 pts. 11,488
  8. Avatar for Museka 18. Museka Lv 1 46 pts. 11,480
  9. Avatar for Steven Pletsch 19. Steven Pletsch Lv 1 44 pts. 11,472
  10. Avatar for vakobo 20. vakobo Lv 1 42 pts. 11,441

Comments