Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 11,749
  2. Avatar for Go Science 2. Go Science 70 pts. 11,732
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 11,729
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,685
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 11,670
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 11,572
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 11,489
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 11,472
  9. Avatar for Russian team 9. Russian team 2 pts. 11,441
  10. Avatar for Contenders 10. Contenders 1 pt. 11,417
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 65 pts. 11,580
  2. Avatar for nicobul 12. nicobul Lv 1 62 pts. 11,572
  3. Avatar for jobo0502 13. jobo0502 Lv 1 59 pts. 11,557
  4. Avatar for frood66 14. frood66 Lv 1 56 pts. 11,553
  5. Avatar for smilingone 15. smilingone Lv 1 54 pts. 11,493
  6. Avatar for O Seki To 16. O Seki To Lv 1 51 pts. 11,489
  7. Avatar for pvc78 17. pvc78 Lv 1 49 pts. 11,488
  8. Avatar for Museka 18. Museka Lv 1 46 pts. 11,480
  9. Avatar for Steven Pletsch 19. Steven Pletsch Lv 1 44 pts. 11,472
  10. Avatar for vakobo 20. vakobo Lv 1 42 pts. 11,441

Comments