Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for Skippysk8s 21. Skippysk8s Lv 1 40 pts. 11,439
  2. Avatar for phi16 22. phi16 Lv 1 38 pts. 11,433
  3. Avatar for georg137 23. georg137 Lv 1 36 pts. 11,417
  4. Avatar for crpainter 24. crpainter Lv 1 34 pts. 11,391
  5. Avatar for silent gene 25. silent gene Lv 1 33 pts. 11,382
  6. Avatar for fpc 26. fpc Lv 1 31 pts. 11,378
  7. Avatar for Norrjane 27. Norrjane Lv 1 29 pts. 11,370
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 28 pts. 11,368
  9. Avatar for guineapig 29. guineapig Lv 1 26 pts. 11,361
  10. Avatar for Keresto 30. Keresto Lv 1 25 pts. 11,347

Comments