Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 11,749
  2. Avatar for Go Science 2. Go Science 70 pts. 11,732
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 11,729
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,685
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 11,670
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 11,572
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 11,489
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 11,472
  9. Avatar for Russian team 9. Russian team 2 pts. 11,441
  10. Avatar for Contenders 10. Contenders 1 pt. 11,417
  1. Avatar for Skippysk8s 21. Skippysk8s Lv 1 40 pts. 11,439
  2. Avatar for phi16 22. phi16 Lv 1 38 pts. 11,433
  3. Avatar for georg137 23. georg137 Lv 1 36 pts. 11,417
  4. Avatar for crpainter 24. crpainter Lv 1 34 pts. 11,391
  5. Avatar for silent gene 25. silent gene Lv 1 33 pts. 11,382
  6. Avatar for fpc 26. fpc Lv 1 31 pts. 11,378
  7. Avatar for Norrjane 27. Norrjane Lv 1 29 pts. 11,370
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 28 pts. 11,368
  9. Avatar for guineapig 29. guineapig Lv 1 26 pts. 11,361
  10. Avatar for Keresto 30. Keresto Lv 1 25 pts. 11,347

Comments