Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for Maerlyn138 61. Maerlyn138 Lv 1 3 pts. 10,760
  2. Avatar for cbwest 62. cbwest Lv 1 3 pts. 10,757
  3. Avatar for rinze 63. rinze Lv 1 3 pts. 10,726
  4. Avatar for carsonfb 64. carsonfb Lv 1 3 pts. 10,696
  5. Avatar for Pawel Tluscik 65. Pawel Tluscik Lv 1 3 pts. 10,670
  6. Avatar for Hellcat6 66. Hellcat6 Lv 1 2 pts. 10,661
  7. Avatar for ManVsYard 67. ManVsYard Lv 1 2 pts. 10,633
  8. Avatar for harvardman 68. harvardman Lv 1 2 pts. 10,596
  9. Avatar for GUANINJIN 69. GUANINJIN Lv 1 2 pts. 10,595
  10. Avatar for Grom 70. Grom Lv 1 2 pts. 10,567

Comments