Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for Maerlyn138 61. Maerlyn138 Lv 1 3 pts. 10,760
  2. Avatar for cbwest 62. cbwest Lv 1 3 pts. 10,757
  3. Avatar for rinze 63. rinze Lv 1 3 pts. 10,726
  4. Avatar for carsonfb 64. carsonfb Lv 1 3 pts. 10,696
  5. Avatar for Pawel Tluscik 65. Pawel Tluscik Lv 1 3 pts. 10,670
  6. Avatar for Hellcat6 66. Hellcat6 Lv 1 2 pts. 10,661
  7. Avatar for ManVsYard 67. ManVsYard Lv 1 2 pts. 10,633
  8. Avatar for harvardman 68. harvardman Lv 1 2 pts. 10,596
  9. Avatar for GUANINJIN 69. GUANINJIN Lv 1 2 pts. 10,595
  10. Avatar for Grom 70. Grom Lv 1 2 pts. 10,567

Comments