Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 11,749
  2. Avatar for Go Science 2. Go Science 70 pts. 11,732
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 11,729
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,685
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 11,670
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 11,572
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 11,489
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 11,472
  9. Avatar for Russian team 9. Russian team 2 pts. 11,441
  10. Avatar for Contenders 10. Contenders 1 pt. 11,417
  1. Avatar for Maerlyn138 61. Maerlyn138 Lv 1 3 pts. 10,760
  2. Avatar for cbwest 62. cbwest Lv 1 3 pts. 10,757
  3. Avatar for rinze 63. rinze Lv 1 3 pts. 10,726
  4. Avatar for carsonfb 64. carsonfb Lv 1 3 pts. 10,696
  5. Avatar for Pawel Tluscik 65. Pawel Tluscik Lv 1 3 pts. 10,670
  6. Avatar for Hellcat6 66. Hellcat6 Lv 1 2 pts. 10,661
  7. Avatar for ManVsYard 67. ManVsYard Lv 1 2 pts. 10,633
  8. Avatar for harvardman 68. harvardman Lv 1 2 pts. 10,596
  9. Avatar for GUANINJIN 69. GUANINJIN Lv 1 2 pts. 10,595
  10. Avatar for Grom 70. Grom Lv 1 2 pts. 10,567

Comments