Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470

  1. Avatar for softbear 71. softbear Lv 1 2 pts. 10,518
  2. Avatar for Mrubiquitin 72. Mrubiquitin Lv 1 2 pts. 10,509
  3. Avatar for Squirrely 73. Squirrely Lv 1 1 pt. 10,486
  4. Avatar for frostschutz 74. frostschutz Lv 1 1 pt. 10,479
  5. Avatar for WBarme1234 75. WBarme1234 Lv 1 1 pt. 10,477
  6. Avatar for stephendl102 76. stephendl102 Lv 1 1 pt. 10,470
  7. Avatar for pioneer_round 77. pioneer_round Lv 1 1 pt. 10,464
  8. Avatar for Blipperman 78. Blipperman Lv 1 1 pt. 10,462
  9. Avatar for cobaltteal 79. cobaltteal Lv 1 1 pt. 10,461
  10. Avatar for rabamino12358 80. rabamino12358 Lv 1 1 pt. 10,429

Comments