Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Gargleblasters 100 pts. 11,749
  2. Avatar for Go Science 2. Go Science 70 pts. 11,732
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 11,729
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,685
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 11,670
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 11,572
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 11,489
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 11,472
  9. Avatar for Russian team 9. Russian team 2 pts. 11,441
  10. Avatar for Contenders 10. Contenders 1 pt. 11,417

  1. Avatar for softbear 71. softbear Lv 1 2 pts. 10,518
  2. Avatar for Mrubiquitin 72. Mrubiquitin Lv 1 2 pts. 10,509
  3. Avatar for Squirrely 73. Squirrely Lv 1 1 pt. 10,486
  4. Avatar for frostschutz 74. frostschutz Lv 1 1 pt. 10,479
  5. Avatar for WBarme1234 75. WBarme1234 Lv 1 1 pt. 10,477
  6. Avatar for stephendl102 76. stephendl102 Lv 1 1 pt. 10,470
  7. Avatar for pioneer_round 77. pioneer_round Lv 1 1 pt. 10,464
  8. Avatar for Blipperman 78. Blipperman Lv 1 1 pt. 10,462
  9. Avatar for cobaltteal 79. cobaltteal Lv 1 1 pt. 10,461
  10. Avatar for rabamino12358 80. rabamino12358 Lv 1 1 pt. 10,429

Comments