Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for NateAGeek 81. NateAGeek Lv 1 1 pt. 10,408
  2. Avatar for Willyanto 82. Willyanto Lv 1 1 pt. 10,400
  3. Avatar for alyssa_d 83. alyssa_d Lv 1 1 pt. 10,346
  4. Avatar for doctaven 84. doctaven Lv 1 1 pt. 10,320
  5. Avatar for manu8170 85. manu8170 Lv 1 1 pt. 10,304
  6. Avatar for RyeSnake 86. RyeSnake Lv 1 1 pt. 10,259
  7. Avatar for kevin everington 87. kevin everington Lv 1 1 pt. 10,247
  8. Avatar for ourtown 88. ourtown Lv 1 1 pt. 10,221
  9. Avatar for Deleted player 89. Deleted player pts. 10,216
  10. Avatar for lconor 90. lconor Lv 1 1 pt. 10,189

Comments