Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,346
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 10,320
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,182
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 9,964
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,470
  1. Avatar for NateAGeek 81. NateAGeek Lv 1 1 pt. 10,408
  2. Avatar for Willyanto 82. Willyanto Lv 1 1 pt. 10,400
  3. Avatar for alyssa_d 83. alyssa_d Lv 1 1 pt. 10,346
  4. Avatar for doctaven 84. doctaven Lv 1 1 pt. 10,320
  5. Avatar for manu8170 85. manu8170 Lv 1 1 pt. 10,304
  6. Avatar for RyeSnake 86. RyeSnake Lv 1 1 pt. 10,259
  7. Avatar for kevin everington 87. kevin everington Lv 1 1 pt. 10,247
  8. Avatar for ourtown 88. ourtown Lv 1 1 pt. 10,221
  9. Avatar for Deleted player 89. Deleted player pts. 10,216
  10. Avatar for lconor 90. lconor Lv 1 1 pt. 10,189

Comments