Placeholder image of a protein
Icon representing a puzzle

1702: Revisiting Puzzle 61: Designer Protein Top7

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 11,749
  2. Avatar for Go Science 2. Go Science 70 pts. 11,732
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 11,729
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,685
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 11,670
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 11,572
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 11,489
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 11,472
  9. Avatar for Russian team 9. Russian team 2 pts. 11,441
  10. Avatar for Contenders 10. Contenders 1 pt. 11,417
  1. Avatar for NateAGeek 81. NateAGeek Lv 1 1 pt. 10,408
  2. Avatar for Willyanto 82. Willyanto Lv 1 1 pt. 10,400
  3. Avatar for alyssa_d 83. alyssa_d Lv 1 1 pt. 10,346
  4. Avatar for doctaven 84. doctaven Lv 1 1 pt. 10,320
  5. Avatar for manu8170 85. manu8170 Lv 1 1 pt. 10,304
  6. Avatar for RyeSnake 86. RyeSnake Lv 1 1 pt. 10,259
  7. Avatar for kevin everington 87. kevin everington Lv 1 1 pt. 10,247
  8. Avatar for ourtown 88. ourtown Lv 1 1 pt. 10,221
  9. Avatar for Deleted player 89. Deleted player pts. 10,216
  10. Avatar for lconor 90. lconor Lv 1 1 pt. 10,189

Comments