Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,128
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,106
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 9,972
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,351
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 9,231
  1. Avatar for silent gene 21. silent gene Lv 1 38 pts. 10,182
  2. Avatar for jobo0502 22. jobo0502 Lv 1 36 pts. 10,178
  3. Avatar for johngran 23. johngran Lv 1 34 pts. 10,177
  4. Avatar for TastyMunchies 24. TastyMunchies Lv 1 33 pts. 10,175
  5. Avatar for phi16 25. phi16 Lv 1 31 pts. 10,174
  6. Avatar for Timo van der Laan 26. Timo van der Laan Lv 1 29 pts. 10,171
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 28 pts. 10,171
  8. Avatar for vakobo 28. vakobo Lv 1 26 pts. 10,165
  9. Avatar for fiendish_ghoul 29. fiendish_ghoul Lv 1 25 pts. 10,159
  10. Avatar for aznarog 30. aznarog Lv 1 23 pts. 10,151

Comments