Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,239
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,229
  3. Avatar for Contenders 3. Contenders 47 pts. 10,219
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,217
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,209
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 10,209
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 10,190
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,171
  10. Avatar for Russian team 10. Russian team 1 pt. 10,165
  1. Avatar for silent gene 21. silent gene Lv 1 38 pts. 10,182
  2. Avatar for jobo0502 22. jobo0502 Lv 1 36 pts. 10,178
  3. Avatar for johngran 23. johngran Lv 1 34 pts. 10,177
  4. Avatar for TastyMunchies 24. TastyMunchies Lv 1 33 pts. 10,175
  5. Avatar for phi16 25. phi16 Lv 1 31 pts. 10,174
  6. Avatar for Timo van der Laan 26. Timo van der Laan Lv 1 29 pts. 10,171
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 28 pts. 10,171
  8. Avatar for vakobo 28. vakobo Lv 1 26 pts. 10,165
  9. Avatar for fiendish_ghoul 29. fiendish_ghoul Lv 1 25 pts. 10,159
  10. Avatar for aznarog 30. aznarog Lv 1 23 pts. 10,151

Comments