Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,128
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,106
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 9,972
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,351
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 9,231
  1. Avatar for gurch 41. gurch Lv 1 12 pts. 10,106
  2. Avatar for Museka 42. Museka Lv 1 11 pts. 10,102
  3. Avatar for grogar7 43. grogar7 Lv 1 10 pts. 10,095
  4. Avatar for Merf 44. Merf Lv 1 10 pts. 10,090
  5. Avatar for jamiexq 45. jamiexq Lv 1 9 pts. 10,061
  6. Avatar for cbwest 46. cbwest Lv 1 8 pts. 10,045
  7. Avatar for rezaefar 47. rezaefar Lv 1 8 pts. 10,044
  8. Avatar for godel9 48. godel9 Lv 1 7 pts. 10,008
  9. Avatar for stomjoh 49. stomjoh Lv 1 7 pts. 10,007
  10. Avatar for carsonfb 50. carsonfb Lv 1 6 pts. 10,006

Comments