1716: Revisiting Puzzle 66: Cytochrome
Closed since over 6 years ago
Novice Overall PredictionSummary
- Created
- August 19, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK