Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,239
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,229
  3. Avatar for Contenders 3. Contenders 47 pts. 10,219
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,217
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,209
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 10,209
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 10,190
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,171
  10. Avatar for Russian team 10. Russian team 1 pt. 10,165
  1. Avatar for 181818 61. 181818 Lv 1 3 pts. 9,886
  2. Avatar for roman madala 62. roman madala Lv 1 3 pts. 9,872
  3. Avatar for neon_fuzz 63. neon_fuzz Lv 1 2 pts. 9,868
  4. Avatar for Glen B 64. Glen B Lv 1 2 pts. 9,859
  5. Avatar for Willyanto 65. Willyanto Lv 1 2 pts. 9,856
  6. Avatar for heather-1 66. heather-1 Lv 1 2 pts. 9,841
  7. Avatar for Silvercraft 67. Silvercraft Lv 1 2 pts. 9,839
  8. Avatar for Arne Heessels 68. Arne Heessels Lv 1 2 pts. 9,807
  9. Avatar for WBarme1234 69. WBarme1234 Lv 1 2 pts. 9,766
  10. Avatar for FoldUp47 70. FoldUp47 Lv 1 1 pt. 9,745

Comments