Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,239
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,229
  3. Avatar for Contenders 3. Contenders 47 pts. 10,219
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,217
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,209
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 10,209
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 10,190
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,171
  10. Avatar for Russian team 10. Russian team 1 pt. 10,165
  1. Avatar for cobaltteal 71. cobaltteal Lv 1 1 pt. 9,744
  2. Avatar for minhhungtuan 72. minhhungtuan Lv 1 1 pt. 9,743
  3. Avatar for kevin everington 73. kevin everington Lv 1 1 pt. 9,737
  4. Avatar for dbuske 74. dbuske Lv 1 1 pt. 9,733
  5. Avatar for Hellcat6 75. Hellcat6 Lv 1 1 pt. 9,703
  6. Avatar for rinze 76. rinze Lv 1 1 pt. 9,702
  7. Avatar for boondog 77. boondog Lv 1 1 pt. 9,695
  8. Avatar for pfirth 78. pfirth Lv 1 1 pt. 9,674
  9. Avatar for navn 79. navn Lv 1 1 pt. 9,674
  10. Avatar for Alice_C 80. Alice_C Lv 1 1 pt. 9,668

Comments