Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,490
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,465
  3. Avatar for Go Science 3. Go Science 41 pts. 10,406
  4. Avatar for HMT heritage 4. HMT heritage 24 pts. 10,357
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 10,336
  6. Avatar for Contenders 6. Contenders 7 pts. 10,325
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 10,313
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,313
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 10,308
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 10,217
  1. Avatar for O Seki To 11. O Seki To Lv 1 62 pts. 10,357
  2. Avatar for Phyx 12. Phyx Lv 1 59 pts. 10,356
  3. Avatar for phi16 13. phi16 Lv 1 56 pts. 10,343
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 53 pts. 10,336
  5. Avatar for robgee 15. robgee Lv 1 50 pts. 10,335
  6. Avatar for crpainter 16. crpainter Lv 1 48 pts. 10,325
  7. Avatar for anthion 17. anthion Lv 1 45 pts. 10,313
  8. Avatar for nicobul 18. nicobul Lv 1 43 pts. 10,308
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 41 pts. 10,299
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 39 pts. 10,294

Comments