Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,490
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,465
  3. Avatar for Go Science 3. Go Science 41 pts. 10,406
  4. Avatar for HMT heritage 4. HMT heritage 24 pts. 10,357
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 10,336
  6. Avatar for Contenders 6. Contenders 7 pts. 10,325
  7. Avatar for Marvin's bunch 7. Marvin's bunch 4 pts. 10,313
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,313
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 1 pt. 10,308
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 10,217
  1. Avatar for cbwest 41. cbwest Lv 1 10 pts. 10,129
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 10 pts. 10,129
  3. Avatar for Blipperman 43. Blipperman Lv 1 9 pts. 10,114
  4. Avatar for JSmith48 44. JSmith48 Lv 1 8 pts. 10,103
  5. Avatar for alcor29 45. alcor29 Lv 1 8 pts. 10,083
  6. Avatar for TurtleByte 46. TurtleByte Lv 1 7 pts. 10,083
  7. Avatar for DAMilwaukeeWisconsin 47. DAMilwaukeeWisconsin Lv 1 7 pts. 10,076
  8. Avatar for NotJim99 48. NotJim99 Lv 1 6 pts. 10,071
  9. Avatar for rezaefar 49. rezaefar Lv 1 6 pts. 10,058
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 5 pts. 10,048

Comments