Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 10,728
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,719
  3. Avatar for Go Science 3. Go Science 47 pts. 10,696
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,643
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,633
  6. Avatar for Contenders 6. Contenders 11 pts. 10,561
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,532
  8. Avatar for Russian team 8. Russian team 4 pts. 10,470
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 10,466
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,439
  1. Avatar for Arne Heessels 91. Arne Heessels Lv 1 1 pt. 9,400
  2. Avatar for gurch 92. gurch Lv 1 1 pt. 9,376
  3. Avatar for franse 93. franse Lv 1 1 pt. 9,351
  4. Avatar for frostschutz 94. frostschutz Lv 1 1 pt. 9,297
  5. Avatar for yaoyy 95. yaoyy Lv 1 1 pt. 9,206
  6. Avatar for Willyanto 96. Willyanto Lv 1 1 pt. 9,172
  7. Avatar for theman9 97. theman9 Lv 1 1 pt. 9,121
  8. Avatar for softbear 98. softbear Lv 1 1 pt. 9,079
  9. Avatar for katling 99. katling Lv 1 1 pt. 9,066
  10. Avatar for pa2040 100. pa2040 Lv 1 1 pt. 8,969

Comments