Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for HMT heritage 100 pts. 10,728
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,719
  3. Avatar for Go Science 3. Go Science 47 pts. 10,696
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,643
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,633
  6. Avatar for Contenders 6. Contenders 11 pts. 10,561
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,532
  8. Avatar for Russian team 8. Russian team 4 pts. 10,470
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 10,466
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,439

  1. Avatar for JasperD 71. JasperD Lv 1 2 pts. 9,882
  2. Avatar for RyeSnake 72. RyeSnake Lv 1 1 pt. 9,878
  3. Avatar for cobaltteal 73. cobaltteal Lv 1 1 pt. 9,862
  4. Avatar for kitek314_pl 74. kitek314_pl Lv 1 1 pt. 9,849
  5. Avatar for Tinkledeath 75. Tinkledeath Lv 1 1 pt. 9,816
  6. Avatar for xbp 76. xbp Lv 1 1 pt. 9,751
  7. Avatar for Silvercraft 77. Silvercraft Lv 1 1 pt. 9,720
  8. Avatar for WBarme1234 78. WBarme1234 Lv 1 1 pt. 9,688
  9. Avatar for rinze 79. rinze Lv 1 1 pt. 9,683
  10. Avatar for dbuske 80. dbuske Lv 1 1 pt. 9,682

Comments