Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 10,728
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,719
  3. Avatar for Go Science 3. Go Science 47 pts. 10,696
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,643
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,633
  6. Avatar for Contenders 6. Contenders 11 pts. 10,561
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,532
  8. Avatar for Russian team 8. Russian team 4 pts. 10,470
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 10,466
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,439
  1. Avatar for DAMilwaukeeWisconsin 51. DAMilwaukeeWisconsin Lv 1 7 pts. 10,127
  2. Avatar for fpc 52. fpc Lv 1 6 pts. 10,092
  3. Avatar for Altercomp 53. Altercomp Lv 1 6 pts. 10,010
  4. Avatar for Glen B 54. Glen B Lv 1 5 pts. 9,988
  5. Avatar for heather-1 55. heather-1 Lv 1 5 pts. 9,981
  6. Avatar for dd-2 56. dd-2 Lv 1 5 pts. 9,979
  7. Avatar for alcor29 57. alcor29 Lv 1 4 pts. 9,971
  8. Avatar for Pawel Tluscik 58. Pawel Tluscik Lv 1 4 pts. 9,966
  9. Avatar for hansvandenhof 59. hansvandenhof Lv 1 4 pts. 9,935
  10. Avatar for Artoria2e5 60. Artoria2e5 Lv 1 3 pts. 9,934

Comments