Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105
  1. Avatar for manu8170 51. manu8170 Lv 1 8 pts. 9,694
  2. Avatar for joaniegirl 52. joaniegirl Lv 1 8 pts. 9,660
  3. Avatar for ManVsYard 53. ManVsYard Lv 1 7 pts. 9,644
  4. Avatar for Arne Heessels 54. Arne Heessels Lv 1 7 pts. 9,617
  5. Avatar for jausmh 55. jausmh Lv 1 6 pts. 9,601
  6. Avatar for cbwest 56. cbwest Lv 1 6 pts. 9,600
  7. Avatar for cobaltteal 57. cobaltteal Lv 1 6 pts. 9,574
  8. Avatar for Alistair69 58. Alistair69 Lv 1 5 pts. 9,552
  9. Avatar for id566488 59. id566488 Lv 1 5 pts. 9,504
  10. Avatar for dbuske 60. dbuske Lv 1 5 pts. 9,486

Comments