Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105
  1. Avatar for lconor 81. lconor Lv 1 1 pt. 8,981
  2. Avatar for IHGreenman 82. IHGreenman Lv 1 1 pt. 8,919
  3. Avatar for Willyanto 83. Willyanto Lv 1 1 pt. 8,904
  4. Avatar for xbp 84. xbp Lv 1 1 pt. 8,864
  5. Avatar for boondog 85. boondog Lv 1 1 pt. 8,825
  6. Avatar for kubek915 86. kubek915 Lv 1 1 pt. 8,792
  7. Avatar for Vinara 87. Vinara Lv 1 1 pt. 8,778
  8. Avatar for Applehihi 88. Applehihi Lv 1 1 pt. 8,765
  9. Avatar for heyubob 89. heyubob Lv 1 1 pt. 8,755
  10. Avatar for bolloforbio 90. bolloforbio Lv 1 1 pt. 8,730

Comments