Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105
  1. Avatar for abiogenesis 91. abiogenesis Lv 1 1 pt. 8,682
  2. Avatar for henrygi 92. henrygi Lv 1 1 pt. 8,680
  3. Avatar for Hahakigi1 93. Hahakigi1 Lv 1 1 pt. 8,656
  4. Avatar for Kayoung 94. Kayoung Lv 1 1 pt. 8,635
  5. Avatar for lamoille 95. lamoille Lv 1 1 pt. 8,612
  6. Avatar for DipsyDoodle2016 96. DipsyDoodle2016 Lv 1 1 pt. 8,589
  7. Avatar for vuvuvu 97. vuvuvu Lv 1 1 pt. 8,587
  8. Avatar for Astralist 98. Astralist Lv 1 1 pt. 8,578
  9. Avatar for harvardman 99. harvardman Lv 1 1 pt. 8,499
  10. Avatar for Swarna Surya 100. Swarna Surya Lv 1 1 pt. 8,470

Comments