Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,177
  2. Avatar for Void Crushers 2. Void Crushers 73 pts. 10,144
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 10,129
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 10,129
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,116
  6. Avatar for Beta Folders 6. Beta Folders 16 pts. 10,109
  7. Avatar for Russian team 7. Russian team 10 pts. 10,074
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 10,016
  10. Avatar for Contenders 10. Contenders 2 pts. 10,001
  1. Avatar for urehman 111. urehman Lv 1 1 pt. 8,960
  2. Avatar for navn 112. navn Lv 1 1 pt. 8,955
  3. Avatar for rmoretti 113. rmoretti Lv 1 1 pt. 8,831
  4. Avatar for Seikarii 114. Seikarii Lv 1 1 pt. 8,785
  5. Avatar for heyubob 115. heyubob Lv 1 1 pt. 8,417
  6. Avatar for 01010011111 116. 01010011111 Lv 1 1 pt. 8,280
  7. Avatar for RockOn 117. RockOn Lv 1 1 pt. 7,780
  8. Avatar for jflat06 118. jflat06 Lv 1 1 pt. 7,652
  9. Avatar for 11811327 119. 11811327 Lv 1 1 pt. 6,190
  10. Avatar for laundryfolding 120. laundryfolding Lv 1 1 pt. 3,015

Comments