Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups


  1. Avatar for Go Science 100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487

  1. Avatar for Anamfija 111. Anamfija Lv 1 1 pt. 6,248
  2. Avatar for frostschutz 112. frostschutz Lv 1 1 pt. 6,234
  3. Avatar for Naija1 113. Naija1 Lv 1 1 pt. 5,972
  4. Avatar for Anonymous Folder 115. Anonymous Folder Lv 1 1 pt. 5,459
  5. Avatar for Simon Baraldi 116. Simon Baraldi Lv 1 1 pt. 4,944
  6. Avatar for urehman 117. urehman Lv 1 1 pt. 4,639
  7. Avatar for 01010011111 118. 01010011111 Lv 1 1 pt. 3,761
  8. Avatar for Tehnologik1 119. Tehnologik1 Lv 1 1 pt. 0
  9. Avatar for aspadistra 120. aspadistra Lv 1 1 pt. 0

Comments