Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487
  1. Avatar for lconor 101. lconor Lv 1 1 pt. 8,106
  2. Avatar for dbuske 102. dbuske Lv 1 1 pt. 8,090
  3. Avatar for Willyanto 103. Willyanto Lv 1 1 pt. 7,954
  4. Avatar for donuts554 104. donuts554 Lv 1 1 pt. 7,670
  5. Avatar for jtscott 105. jtscott Lv 1 1 pt. 7,645
  6. Avatar for jacalbr 106. jacalbr Lv 1 1 pt. 7,265
  7. Avatar for z5131k 107. z5131k Lv 1 1 pt. 7,218
  8. Avatar for Merf 108. Merf Lv 1 1 pt. 7,140
  9. Avatar for borattt 109. borattt Lv 1 1 pt. 6,807
  10. Avatar for xythus 110. xythus Lv 1 1 pt. 6,640

Comments