Placeholder image of a protein
Icon representing a puzzle

1751: Unsolved De-novo Freestyle 156

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

AEYMVLQLILLQIYVKVMLEETEDEKKIRDFVDDMRKKMLEYIKKKIEDEYQVRIWEKIIKEIIERVLKD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,231
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,039
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 9,999
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,971
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,941
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 9,934
  7. Avatar for Russian team 7. Russian team 10 pts. 9,886
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,839
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,836
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,487
  1. Avatar for FoldUp47 81. FoldUp47 Lv 1 1 pt. 8,800
  2. Avatar for kitek314_pl 82. kitek314_pl Lv 1 1 pt. 8,798
  3. Avatar for Psych0Active 83. Psych0Active Lv 1 1 pt. 8,788
  4. Avatar for Arne Heessels 84. Arne Heessels Lv 1 1 pt. 8,783
  5. Avatar for rabamino12358 85. rabamino12358 Lv 1 1 pt. 8,777
  6. Avatar for boondog 86. boondog Lv 1 1 pt. 8,719
  7. Avatar for joaniegirl 87. joaniegirl Lv 1 1 pt. 8,696
  8. Avatar for Alistair69 88. Alistair69 Lv 1 1 pt. 8,665
  9. Avatar for Andi1960 89. Andi1960 Lv 1 1 pt. 8,576
  10. Avatar for lange 90. lange Lv 1 1 pt. 8,542

Comments