Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,534
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,520
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,451
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,962
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 8,688
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,479
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 7,648
  1. Avatar for poiuytrewq987 91. poiuytrewq987 Lv 1 1 pt. 8,710
  2. Avatar for orsa19 92. orsa19 Lv 1 1 pt. 8,700
  3. Avatar for liuser 93. liuser Lv 1 1 pt. 8,691
  4. Avatar for Bithalbierer 94. Bithalbierer Lv 1 1 pt. 8,688
  5. Avatar for lconor 95. lconor Lv 1 1 pt. 8,609
  6. Avatar for Wipf 96. Wipf Lv 1 1 pt. 8,588
  7. Avatar for johngran 97. johngran Lv 1 1 pt. 8,566
  8. Avatar for alyssa_d_V2.0 98. alyssa_d_V2.0 Lv 1 1 pt. 8,479
  9. Avatar for rezaefar 99. rezaefar Lv 1 1 pt. 8,478
  10. Avatar for Kim Ye-eun 100. Kim Ye-eun Lv 1 1 pt. 8,397

Comments