Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,024
  2. Avatar for HMT heritage 2. HMT heritage 73 pts. 10,022
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 9,982
  4. Avatar for Go Science 4. Go Science 36 pts. 9,865
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,767
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,765
  7. Avatar for Hold My Beer 7. Hold My Beer 10 pts. 9,688
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 9,585
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 4 pts. 9,574
  10. Avatar for Russian team 10. Russian team 2 pts. 9,571
  1. Avatar for poiuytrewq987 91. poiuytrewq987 Lv 1 1 pt. 8,710
  2. Avatar for orsa19 92. orsa19 Lv 1 1 pt. 8,700
  3. Avatar for liuser 93. liuser Lv 1 1 pt. 8,691
  4. Avatar for Bithalbierer 94. Bithalbierer Lv 1 1 pt. 8,688
  5. Avatar for lconor 95. lconor Lv 1 1 pt. 8,609
  6. Avatar for Wipf 96. Wipf Lv 1 1 pt. 8,588
  7. Avatar for johngran 97. johngran Lv 1 1 pt. 8,566
  8. Avatar for alyssa_d_V2.0 98. alyssa_d_V2.0 Lv 1 1 pt. 8,479
  9. Avatar for rezaefar 99. rezaefar Lv 1 1 pt. 8,478
  10. Avatar for Kim Ye-eun 100. Kim Ye-eun Lv 1 1 pt. 8,397

Comments