Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,534
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,520
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,451
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,962
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 8,688
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,479
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 7,648
  1. Avatar for Jim Fraser 101. Jim Fraser Lv 1 1 pt. 8,377
  2. Avatar for Andi1960 102. Andi1960 Lv 1 1 pt. 8,367
  3. Avatar for harvardman 103. harvardman Lv 1 1 pt. 8,258
  4. Avatar for Bautho 104. Bautho Lv 1 1 pt. 8,239
  5. Avatar for jausmh 105. jausmh Lv 1 1 pt. 8,223
  6. Avatar for gottfrii 106. gottfrii Lv 1 1 pt. 8,087
  7. Avatar for Kiwi2kiwi 107. Kiwi2kiwi Lv 1 1 pt. 7,722
  8. Avatar for vuvuvu 108. vuvuvu Lv 1 1 pt. 7,648
  9. Avatar for TheActualStephenColbert 109. TheActualStephenColbert Lv 1 1 pt. 7,397
  10. Avatar for Kaktusn777 110. Kaktusn777 Lv 1 1 pt. 7,355

Comments