Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,024
  2. Avatar for HMT heritage 2. HMT heritage 73 pts. 10,022
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 9,982
  4. Avatar for Go Science 4. Go Science 36 pts. 9,865
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,767
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,765
  7. Avatar for Hold My Beer 7. Hold My Beer 10 pts. 9,688
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 9,585
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 4 pts. 9,574
  10. Avatar for Russian team 10. Russian team 2 pts. 9,571

  1. Avatar for Jim Fraser 101. Jim Fraser Lv 1 1 pt. 8,377
  2. Avatar for Andi1960 102. Andi1960 Lv 1 1 pt. 8,367
  3. Avatar for harvardman 103. harvardman Lv 1 1 pt. 8,258
  4. Avatar for Bautho 104. Bautho Lv 1 1 pt. 8,239
  5. Avatar for jausmh 105. jausmh Lv 1 1 pt. 8,223
  6. Avatar for gottfrii 106. gottfrii Lv 1 1 pt. 8,087
  7. Avatar for Kiwi2kiwi 107. Kiwi2kiwi Lv 1 1 pt. 7,722
  8. Avatar for vuvuvu 108. vuvuvu Lv 1 1 pt. 7,648
  9. Avatar for Kaktusn777 110. Kaktusn777 Lv 1 1 pt. 7,355

Comments