Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Contenders 11. Contenders 1 pt. 9,534
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,520
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,451
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,962
  5. Avatar for Team Schleswig-Holstein 15. Team Schleswig-Holstein 1 pt. 8,688
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,479
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 7,648
  1. Avatar for Galaxie 11. Galaxie Lv 1 66 pts. 9,790
  2. Avatar for Phyx 12. Phyx Lv 1 63 pts. 9,775
  3. Avatar for Enzyme 13. Enzyme Lv 1 60 pts. 9,767
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 58 pts. 9,765
  5. Avatar for ManVsYard 15. ManVsYard Lv 1 55 pts. 9,762
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 53 pts. 9,743
  7. Avatar for grogar7 17. grogar7 Lv 1 50 pts. 9,732
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 48 pts. 9,727
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 46 pts. 9,719
  10. Avatar for nicobul 20. nicobul Lv 1 44 pts. 9,712

Comments