Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,024
  2. Avatar for HMT heritage 2. HMT heritage 73 pts. 10,022
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 9,982
  4. Avatar for Go Science 4. Go Science 36 pts. 9,865
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,767
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,765
  7. Avatar for Hold My Beer 7. Hold My Beer 10 pts. 9,688
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 9,585
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 4 pts. 9,574
  10. Avatar for Russian team 10. Russian team 2 pts. 9,571
  1. Avatar for Galaxie 11. Galaxie Lv 1 66 pts. 9,790
  2. Avatar for Phyx 12. Phyx Lv 1 63 pts. 9,775
  3. Avatar for Enzyme 13. Enzyme Lv 1 60 pts. 9,767
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 58 pts. 9,765
  5. Avatar for ManVsYard 15. ManVsYard Lv 1 55 pts. 9,762
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 53 pts. 9,743
  7. Avatar for grogar7 17. grogar7 Lv 1 50 pts. 9,732
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 48 pts. 9,727
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 46 pts. 9,719
  10. Avatar for nicobul 20. nicobul Lv 1 44 pts. 9,712

Comments