Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups


  1. Avatar for Contenders 11. Contenders 1 pt. 9,534
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,520
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,451
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,962
  5. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,479
  6. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 7,648

  1. Avatar for kevin everington 51. kevin everington Lv 1 8 pts. 9,451
  2. Avatar for kitek314_pl 52. kitek314_pl Lv 1 7 pts. 9,451
  3. Avatar for Alistair69 53. Alistair69 Lv 1 7 pts. 9,436
  4. Avatar for guineapig 54. guineapig Lv 1 6 pts. 9,436
  5. Avatar for 181818 55. 181818 Lv 1 6 pts. 9,410
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 6 pts. 9,410
  7. Avatar for WBarme1234 57. WBarme1234 Lv 1 5 pts. 9,410
  8. Avatar for bobcat 58. bobcat Lv 1 5 pts. 9,409
  9. Avatar for Glen B 59. Glen B Lv 1 5 pts. 9,386
  10. Avatar for boondog 60. boondog Lv 1 4 pts. 9,384

Comments