Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,024
  2. Avatar for HMT heritage 2. HMT heritage 73 pts. 10,022
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 9,982
  4. Avatar for Go Science 4. Go Science 36 pts. 9,865
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,767
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,765
  7. Avatar for Hold My Beer 7. Hold My Beer 10 pts. 9,688
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 9,585
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 4 pts. 9,574
  10. Avatar for Russian team 10. Russian team 2 pts. 9,571
  1. Avatar for kevin everington 51. kevin everington Lv 1 8 pts. 9,451
  2. Avatar for kitek314_pl 52. kitek314_pl Lv 1 7 pts. 9,451
  3. Avatar for Alistair69 53. Alistair69 Lv 1 7 pts. 9,436
  4. Avatar for guineapig 54. guineapig Lv 1 6 pts. 9,436
  5. Avatar for 181818 55. 181818 Lv 1 6 pts. 9,410
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 6 pts. 9,410
  7. Avatar for WBarme1234 57. WBarme1234 Lv 1 5 pts. 9,410
  8. Avatar for bobcat 58. bobcat Lv 1 5 pts. 9,409
  9. Avatar for Glen B 59. Glen B Lv 1 5 pts. 9,386
  10. Avatar for boondog 60. boondog Lv 1 4 pts. 9,384

Comments