Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,024
  2. Avatar for HMT heritage 2. HMT heritage 73 pts. 10,022
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 9,982
  4. Avatar for Go Science 4. Go Science 36 pts. 9,865
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,767
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,765
  7. Avatar for Hold My Beer 7. Hold My Beer 10 pts. 9,688
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 9,585
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 4 pts. 9,574
  10. Avatar for Russian team 10. Russian team 2 pts. 9,571
  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 25 pts. 9,614
  2. Avatar for aznarog 32. aznarog Lv 1 24 pts. 9,611
  3. Avatar for cbwest 33. cbwest Lv 1 23 pts. 9,608
  4. Avatar for Altercomp 34. Altercomp Lv 1 21 pts. 9,603
  5. Avatar for frood66 35. frood66 Lv 1 20 pts. 9,585
  6. Avatar for Vinara 36. Vinara Lv 1 19 pts. 9,581
  7. Avatar for fpc 37. fpc Lv 1 18 pts. 9,576
  8. Avatar for pauldunn 38. pauldunn Lv 1 17 pts. 9,575
  9. Avatar for Old Chap 39. Old Chap Lv 1 16 pts. 9,574
  10. Avatar for vakobo 40. vakobo Lv 1 15 pts. 9,571

Comments