Placeholder image of a protein
Icon representing a puzzle

1762: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 9,530
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,129
  3. Avatar for Contenders 13. Contenders 1 pt. 9,064
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,786
  5. Avatar for Team New Zealand 15. Team New Zealand 1 pt. 8,737
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 8,737
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 7,778
  8. Avatar for STME 1903 18. STME 1903 1 pt. 3,334
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 65 pts. 10,010
  2. Avatar for fiendish_ghoul 12. fiendish_ghoul Lv 1 62 pts. 9,992
  3. Avatar for Phyx 13. Phyx Lv 1 59 pts. 9,979
  4. Avatar for Idiotboy 14. Idiotboy Lv 1 56 pts. 9,952
  5. Avatar for jobo0502 15. jobo0502 Lv 1 54 pts. 9,948
  6. Avatar for grogar7 16. grogar7 Lv 1 51 pts. 9,943
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 49 pts. 9,942
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 46 pts. 9,895
  9. Avatar for Vinara 19. Vinara Lv 1 44 pts. 9,892
  10. Avatar for robgee 20. robgee Lv 1 42 pts. 9,887

Comments