Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Team New Zealand 11. Team New Zealand 2 pts. 10,145
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,112
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,108
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,976
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 9,864
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,413
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 9,344
  8. Avatar for IB Bio 18. IB Bio 1 pt. 4,734
  1. Avatar for rylomorda 91. rylomorda Lv 1 1 pt. 9,636
  2. Avatar for Silvercraft 92. Silvercraft Lv 1 1 pt. 9,578
  3. Avatar for Jelle De Eiwit Vouwer 93. Jelle De Eiwit Vouwer Lv 1 1 pt. 9,563
  4. Avatar for Anamfija 94. Anamfija Lv 1 1 pt. 9,533
  5. Avatar for YorkG 95. YorkG Lv 1 1 pt. 9,531
  6. Avatar for heyubob 96. heyubob Lv 1 1 pt. 9,506
  7. Avatar for SPooks753 97. SPooks753 Lv 1 1 pt. 9,489
  8. Avatar for KpX 98. KpX Lv 1 1 pt. 9,484
  9. Avatar for felixxy 99. felixxy Lv 1 1 pt. 9,477
  10. Avatar for pluto 100. pluto Lv 1 1 pt. 9,424

Comments