Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Team New Zealand 11. Team New Zealand 2 pts. 10,145
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,112
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,108
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,976
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 9,864
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,413
  7. Avatar for IB Bio 18. IB Bio 1 pt. 4,734

  1. Avatar for Timo van der Laan 21. Timo van der Laan Lv 1 44 pts. 10,446
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 43 pts. 10,446
  3. Avatar for johnmitch 23. johnmitch Lv 1 41 pts. 10,441
  4. Avatar for Galaxie 24. Galaxie Lv 1 39 pts. 10,440
  5. Avatar for cbwest 25. cbwest Lv 1 37 pts. 10,436
  6. Avatar for guineapig 26. guineapig Lv 1 35 pts. 10,435
  7. Avatar for nicobul 27. nicobul Lv 1 34 pts. 10,433
  8. Avatar for Pawel Tluscik 28. Pawel Tluscik Lv 1 32 pts. 10,422
  9. Avatar for frood66 29. frood66 Lv 1 31 pts. 10,420
  10. Avatar for fpc 30. fpc Lv 1 29 pts. 10,419

Comments