Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Team New Zealand 11. Team New Zealand 2 pts. 10,145
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,112
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,108
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,976
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 9,864
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,413
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 9,344
  8. Avatar for IB Bio 18. IB Bio 1 pt. 4,734
  1. Avatar for cobaltteal 51. cobaltteal Lv 1 10 pts. 10,196
  2. Avatar for diamonddays 52. diamonddays Lv 1 9 pts. 10,194
  3. Avatar for WBarme1234 53. WBarme1234 Lv 1 9 pts. 10,184
  4. Avatar for alwen 54. alwen Lv 1 8 pts. 10,160
  5. Avatar for NewZealand 55. NewZealand Lv 1 8 pts. 10,145
  6. Avatar for JasperD 56. JasperD Lv 1 7 pts. 10,112
  7. Avatar for PeterDav 57. PeterDav Lv 1 7 pts. 10,111
  8. Avatar for vuvuvu 58. vuvuvu Lv 1 6 pts. 10,108
  9. Avatar for Altercomp 59. Altercomp Lv 1 6 pts. 10,106
  10. Avatar for hansvandenhof 60. hansvandenhof Lv 1 6 pts. 10,097

Comments