Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Team New Zealand 11. Team New Zealand 2 pts. 10,145
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,112
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,108
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,976
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 9,864
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,413
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 9,344
  8. Avatar for IB Bio 18. IB Bio 1 pt. 4,734
  1. Avatar for Donobit 61. Donobit Lv 1 5 pts. 10,075
  2. Avatar for hada 62. hada Lv 1 5 pts. 10,055
  3. Avatar for neon_fuzz 63. neon_fuzz Lv 1 5 pts. 10,036
  4. Avatar for ManVsYard 64. ManVsYard Lv 1 4 pts. 10,013
  5. Avatar for Glen B 65. Glen B Lv 1 4 pts. 10,011
  6. Avatar for tjrana 66. tjrana Lv 1 4 pts. 9,988
  7. Avatar for alyssa_d_V2.0 67. alyssa_d_V2.0 Lv 1 4 pts. 9,976
  8. Avatar for Arne Heessels 68. Arne Heessels Lv 1 3 pts. 9,965
  9. Avatar for ciberhunter 69. ciberhunter Lv 1 3 pts. 9,955
  10. Avatar for kevin everington 70. kevin everington Lv 1 3 pts. 9,955

Comments