Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Team New Zealand 11. Team New Zealand 2 pts. 10,145
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,112
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,108
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,976
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 9,864
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,413
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 9,344
  8. Avatar for IB Bio 18. IB Bio 1 pt. 4,734
  1. Avatar for pfirth 81. pfirth Lv 1 1 pt. 9,823
  2. Avatar for quantrarily04 82. quantrarily04 Lv 1 1 pt. 9,817
  3. Avatar for bobcat 83. bobcat Lv 1 1 pt. 9,796
  4. Avatar for CAN1958 84. CAN1958 Lv 1 1 pt. 9,779
  5. Avatar for Squirrely 85. Squirrely Lv 1 1 pt. 9,770
  6. Avatar for lange 86. lange Lv 1 1 pt. 9,760
  7. Avatar for RileyBugz1 87. RileyBugz1 Lv 1 1 pt. 9,758
  8. Avatar for boondog 88. boondog Lv 1 1 pt. 9,687
  9. Avatar for t012 89. t012 Lv 1 1 pt. 9,673
  10. Avatar for lconor 90. lconor Lv 1 1 pt. 9,658

Comments