Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,855
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,608
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,024
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,815
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,405
  6. Avatar for Team China 16. Team China 1 pt. 7,187
  1. Avatar for 01010011111 111. 01010011111 Lv 1 1 pt. 6,532
  2. Avatar for SayMyName 112. SayMyName Lv 1 1 pt. 6,532
  3. Avatar for simsun 113. simsun Lv 1 1 pt. 6,478
  4. Avatar for Martyg 114. Martyg Lv 1 1 pt. 5,020
  5. Avatar for BioFurther 115. BioFurther Lv 1 1 pt. 1,962
  6. Avatar for JellyJump 116. JellyJump Lv 1 1 pt. 0
  7. Avatar for htvwhite 117. htvwhite Lv 1 1 pt. 0
  8. Avatar for esiaste 118. esiaste Lv 1 1 pt. 0
  9. Avatar for toshiue 119. toshiue Lv 1 1 pt. 0
  10. Avatar for ManVsYard 120. ManVsYard Lv 1 1 pt. 0

Comments