Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,855
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,608
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,024
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,815
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,405
  6. Avatar for Team China 16. Team China 1 pt. 7,187
  1. Avatar for silent gene 31. silent gene Lv 1 24 pts. 10,023
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 23 pts. 10,011
  3. Avatar for fpc 33. fpc Lv 1 22 pts. 10,004
  4. Avatar for drumpeter18yrs9yrs 34. drumpeter18yrs9yrs Lv 1 21 pts. 9,971
  5. Avatar for guineapig 35. guineapig Lv 1 19 pts. 9,968
  6. Avatar for MicElephant 36. MicElephant Lv 1 18 pts. 9,933
  7. Avatar for WBarme1234 37. WBarme1234 Lv 1 17 pts. 9,885
  8. Avatar for O Seki To 38. O Seki To Lv 1 16 pts. 9,855
  9. Avatar for joremen 39. joremen Lv 1 15 pts. 9,849
  10. Avatar for pvc78 40. pvc78 Lv 1 15 pts. 9,845

Comments